Sitophilus oryzae (rice weevil): 115889945 Help Entry 115889945         CDS       T07985                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism soy  Sitophilus oryzae (rice weevil) Pathway soy04013   MAPK signaling pathway - fly soy04145   Phagosome soy04148   Efferocytosis soy04310   Wnt signaling pathway soy04517   IgSF CAM signaling soy04518   Integrin signaling soy04620   Toll-like receptor signaling pathway soy05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:soy00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     115889945    04310 Wnt signaling pathway     115889945   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     115889945    04518 Integrin signaling     115889945  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     115889945    04148 Efferocytosis     115889945  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     115889945  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     115889945  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:soy04131]     115889945   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:soy04147]     115889945    04031 GTP-binding proteins [BR:soy04031]     115889945 Membrane trafficking [BR:soy04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     115889945  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     115889945   Macropinocytosis    Ras GTPases     115889945  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     115889945 Exosome [BR:soy04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115889945   Exosomal proteins of other body fluids (saliva and urine)    115889945   Exosomal proteins of colorectal cancer cells    115889945   Exosomal proteins of bladder cancer cells    115889945 GTP-binding proteins [BR:soy04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     115889945 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  115889945 NCBI-ProteinID:  XP_030765907 UniProt:  A0A6J2YRH1 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR EDKSTIEKLKDKKLAPITYPQGLAMAKEISAVKYLECSALTQKGLKTVFDEAIRAVLCPV MPPKPKRKCVIL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagcaataaaatgtgttgttgtgggcgatggtgccgttggtaaaacgtgcctgttg atttcctacactacgaatgcctttcctggcgagtacataccgacagttttcgataactat tctgcaaatgtgatggtcgatggtaaacccattaatttaggattgtgggatacggccggt caggaagattacgacaggctgaggcccttgtcttatccacagactgatgtctttctaatc tgtttttccttagttaatcccgcttcattcgagaatgtccgagcaaagtggtaccctgaa gtaagacatcactgcccgaatacgcccattatactagtaggtacaaaattagatctgaga gaagataaaagtacaattgaaaaattgaaagataaaaagctggcaccaattacttatcca caaggcttggcgatggccaaggaaatcagcgccgtcaaatatctagaatgttcggctcta actcaaaaaggactgaaaacggtgttcgacgaagccatcagggcggtgctgtgtcccgtc atgccgcccaaacccaaacgtaaatgtgttattctctaa

DBGET integrated database retrieval system