Spathaspora passalidarum: SPAPADRAFT_151749 Help Entry SPAPADRAFT_151749 CDS       T03101                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism spaa  Spathaspora passalidarum Pathway spaa04145   Phagocytosis spaa04517   IgSF CAM signaling spaa04814   Motor proteins Brite KEGG Orthology (KO) [BR:spaa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     SPAPADRAFT_151749  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     SPAPADRAFT_151749   09142 Cell motility    04814 Motor proteins     SPAPADRAFT_151749  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:spaa03037]     SPAPADRAFT_151749    04812 Cytoskeleton proteins [BR:spaa04812]     SPAPADRAFT_151749 Cilium and associated proteins [BR:spaa03037]  Motile cilia and associated proteins   Dynein arm    SPAPADRAFT_151749 Cytoskeleton proteins [BR:spaa04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      SPAPADRAFT_151749 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop DUF4211 Motif Other DBs NCBI-GeneID:  18870904 NCBI-ProteinID:  XP_007375034 JGI:  151749 UniProt:  G3AMS5 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MTMQEPEHTPTLKASDLSEEIQTKIFELAQQSIVTCKIEKDIATFLKKELDQIYGPTWHV IVGRSFGSYVTHEQGYFIYFYIGDLAFLIFKSG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaccatgcaagaacctgaacatactccaacgttaaaagcatcagatttgtctgaagag atccaaaccaagatatttgaattggcccaacaatctatagtcacttgcaagattgaaaaa gacattgcgacattcttgaagaaggagttggaccagatctatggccctacgtggcatgta attgtaggaaggagctttggaagttatgtcactcatgaacaaggatatttcatctatttt tacatcggtgacttggcattcttgatattcaaaagtggttga

DBGET integrated database retrieval system