Spathaspora passalidarum: SPAPADRAFT_59898 Help Entry SPAPADRAFT_59898  CDS       T03101                                  Name (RefSeq) hypothetical protein   KO K09481   protein transport protein SEC61 subunit beta Organism spaa  Spathaspora passalidarum Pathway spaa03060   Protein export spaa04141   Protein processing in endoplasmic reticulum spaa04145   Phagosome Brite KEGG Orthology (KO) [BR:spaa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SPAPADRAFT_59898    04141 Protein processing in endoplasmic reticulum     SPAPADRAFT_59898  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     SPAPADRAFT_59898  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:spaa04131]     SPAPADRAFT_59898   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:spaa02044]     SPAPADRAFT_59898 Membrane trafficking [BR:spaa04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     SPAPADRAFT_59898 Secretion system [BR:spaa02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    SPAPADRAFT_59898 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  18873127 NCBI-ProteinID:  XP_007374061 JGI:  59898 UniProt:  G3AIR1 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search MSTSQSNPAPGGLRSAVKRKTTADKKAQSTNAMPLSTRSAGAGGSSSTMMKLFTDEAQGL RVDPLVVLFLAVGFIFSVIILHVFAKITGKFTSS NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgtctacatcacaatctaatccagctccaggaggtttaagaagtgcagtcaagaggaag acaactgctgacaagaaggcacaatccactaatgctatgccattatccaccagatcagct ggtgccggtggatcttcttctaccatgatgaaattgtttactgatgaagcccaaggtctt agagttgatcctttggttgtcttgtttttggctgttggtttcatcttttccgttattatc ttacatgttttcgccaagattactggtaaattcacttcttcataa

DBGET integrated database retrieval system