Spathaspora passalidarum: SPAPADRAFT_61604 Help Entry SPAPADRAFT_61604  CDS       T03101                                  Name (RefSeq) hypothetical protein   KO K11511   centromere protein S Organism spaa  Spathaspora passalidarum Pathway spaa03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:spaa00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     SPAPADRAFT_61604  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:spaa03036]     SPAPADRAFT_61604    03400 DNA repair and recombination proteins [BR:spaa03400]     SPAPADRAFT_61604 Chromosome and associated proteins [BR:spaa03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      SPAPADRAFT_61604 DNA repair and recombination proteins [BR:spaa03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      SPAPADRAFT_61604 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Bromo_TP TFIID-18kDa Motif Other DBs NCBI-GeneID:  18873972 NCBI-ProteinID:  XP_007375814 JGI:  61604 UniProt:  G3ANK9 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MAKQTKEQIAVQLKAAIYLHVAKIVEDQLKTMGETNSEEESSVFATPIFISSLVELVYNQ IILLGKDLEMFAEHAGRDVINPSDLFMVTRKNPTLQQYLKDILEKRS NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcaaaacaaaccaaggagcagattgcagttcagttgaaagcagctatatatttgcat gtggccaagatagtcgaagatcaattgaaaaccatgggagaaacaaactccgaagaggaa agttccgtgtttgcaacgccaatttttatttcttccttggttgaattagtatataatcag ataattttattgggaaaagatcttgaaatgtttgctgaacatgcaggaagagatgtgatc aaccccctggatcttttcatggttacgagaaagaatcctacgttgcaacaatatttgaaa gatattttggaaaagagaagttaa

DBGET integrated database retrieval system