Spathaspora passalidarum: SPAPADRAFT_61683 Help Entry SPAPADRAFT_61683  CDS       T03101                                  Name (RefSeq) DNA-directed RNA polymerases I   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism spaa  Spathaspora passalidarum Pathway spaa03020   RNA polymerase spaa03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:spaa00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     SPAPADRAFT_61683   09124 Replication and repair    03420 Nucleotide excision repair     SPAPADRAFT_61683  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:spaa03021]     SPAPADRAFT_61683    03400 DNA repair and recombination proteins [BR:spaa03400]     SPAPADRAFT_61683 Transcription machinery [BR:spaa03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      SPAPADRAFT_61683   RNA polymerase III system    RNA polymerase III      SPAPADRAFT_61683   RNA polymerase I system    RNA polymerase I      SPAPADRAFT_61683 DNA repair and recombination proteins [BR:spaa03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       SPAPADRAFT_61683 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Zn_ribbon_RPAB4 HypA Zn_Ribbon_YjdM HVO_2753_ZBP Zn_ribbon_DZR_6 TackOD1 Zn_ribbon_5 NCD3G FYVE FYDLN_acid DUF7129 FYVE_2 Prok-RING_1 DUF7459 zf-C3HC C1_1 DUF1451 DUF7576 Zn_ribbon_8 IBR_1 Zf_2nd_IFT121 zf-C2H2_DHX34 Motif Other DBs NCBI-GeneID:  18874004 NCBI-ProteinID:  XP_007375896 JGI:  61683 UniProt:  G3ANZ5 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MASPQREGFSIPSSISHAALGQVTSKSLGVKYNCAQCAASFSLSKNDAIRCKECGHRVIY KSRTRRMVQFEAR NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggcctccccacaaagagaagggttcagtatcccatcatcaatctcccatgctgcttta ggtcaagttaccagcaagtccttaggtgttaagtacaactgtgcccaatgtgctgcctcc ttttccttgagcaaaaacgacgccatcagatgtaaggaatgtggtcatagagttatttac aagtctagaaccagaagaatggtgcaatttgaagctcgttaa

DBGET integrated database retrieval system