Spathaspora passalidarum: SPAPADRAFT_62600 Help Entry SPAPADRAFT_62600  CDS       T03101                                  Name (RefSeq) hypothetical protein   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism spaa  Spathaspora passalidarum Pathway spaa03010   Ribosome spaa04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:spaa00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     SPAPADRAFT_62600   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     SPAPADRAFT_62600  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:spaa03011]     SPAPADRAFT_62600    04121 Ubiquitin system [BR:spaa04121]     SPAPADRAFT_62600 Ribosome [BR:spaa03011]  Ribosomal proteins   Eukaryotes    Large subunit     SPAPADRAFT_62600   Archaea     SPAPADRAFT_62600 Ubiquitin system [BR:spaa04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    SPAPADRAFT_62600 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L40e Motif Other DBs NCBI-GeneID:  18874397 NCBI-ProteinID:  XP_007376776 JGI:  62600 UniProt:  G3ASW1 LinkDB All DBs Position Unknown AA seq 52 aa AA seqDB search MIEPSLKALASKYNCEKSICRKCYARLPPRATNCRKRKCGHTNQLRPKKKLK NT seq 159 nt NT seq  +upstreamnt  +downstreamnt atgattgaaccatccttaaaggctttagcttccaagtacaactgtgaaaagtccatctgt cgtaaatgttacgctagattaccaccaagagccaccaactgtcgtaagagaaagtgtggt cacaccaaccaattaagaccaaagaagaagttgaagtaa

DBGET integrated database retrieval system