KEGG   Spathaspora passalidarum: SPAPADRAFT_64526
Entry
SPAPADRAFT_64526  CDS       T03101                                 
Name
(RefSeq) hypothetical protein
  KO
K12575  kinetochore protein SLK19
Organism
spaa  Spathaspora passalidarum
Pathway
spaa04111  Cell cycle - yeast
spaa04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:spaa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    SPAPADRAFT_64526
   04113 Meiosis - yeast
    SPAPADRAFT_64526
SSDB
Motif
Pfam: Fungal_TACC Crescentin TMF_DNA_bd ACT_5 SCO1-SenC
Other DBs
NCBI-GeneID: 18874981
NCBI-ProteinID: XP_007372810
JGI: 64526
UniProt: G3AGR5
LinkDB
Position
Unknown
AA seq 822 aa
MTTPIISPSRKHTHHTKHIIDETLSPVKINLKPVETPPIRNPSKNDVVLIQHPHGLHAKH
EARRNTFGHKRRSLVNTPLIDVKSRRDPMTSPYVNQGISNLDSIKRSKLLLDSQFEKLGK
ENRQPKHLGGEEGDDEDNEDEAEALSSPIKRPSKHKDEPLRKIAKLVTSAESEVIEQGDD
DNNNNNNNDDDDDDVILDDLVERFSKPASSHEETSSPLVIDSSDNEELETDKPADTKLHA
FDHTQLNKIIQDHVHIDYVTPQRYTEPVAKSPGTNQISRINGNLDLKNKEEIDKSLDSTS
PLKQKQLDENVDYYDDETIHRLENEPTINFLMSPNSRPLFSIEQMNKIQQENSKRNEELI
QDIKTRDDTIQLLSEQVNKLQGNLVEHQHQLRELKKTNGELVNIERVLSIQLKHNERELA
SLTKSFKIKESSVFQLSQELSRKSNELTQVESQFTDLTNKVEEIQHLKDDLIEMNDLNEK
YANQIDSLIKERNEIQTQNDDLQGKLETESSEWKDKYEQLNQTYQELKDTNDELRNQLDD
VSTDLSEANGKNEDLKTHLLKFETEVEQLTTTNEQLTMEKEKLTAANQENEKLIKEYDEI
TNNRIADLEQELEETRQKEEREKENSIQLGAQLEEFKQLNKKLEFKIEDLDSEAALLKEE
ITRLETLVKDKTALVEEKDQIISDDMIKLNELVQAVTESREHNNEEVEDLHKQIETLSRD
HAKEIQRLQEKLETSQAEADQEFNRLAQYLHHEYSEKHAKKLGEVKVHFERERDGLIRDK
KAAEREAELLKRKVNHMTSEMKKMTEIYESQTSGSRHRSPNK
NT seq 2469 nt   +upstreamnt  +downstreamnt
atgacaactcctataatatcaccatctaggaaacatacccatcatacaaaacatatcatt
gacgaaaccttatcgccagtaaagatcaacctcaagcccgtggaaacgcctccaatccgc
aaccccagcaaaaacgatgttgtcctaatccagcatccacacggtcttcatgctaaacac
gaagcacgcagaaacacatttggacacaagagacgatcgttagttaatacaccattgatt
gatgttaaatccaggagagaccccatgaccagtccatatgttaaccagggcataagtaac
ttggatagcatcaaacgatccaagcttcttttagatagccaatttgaaaagttgggaaaa
gaaaatagacaacctaagcatttaggaggtgaggaaggagacgacgaagacaacgaagat
gaagccgaagctctaagttcaccaatcaagcgtcctctgaaacacaaggacgaaccattg
aggaaaatagcaaagcttgtaactagtgctgagagtgaggtgattgaacaaggtgatgat
gacaacaacaacaacaacaacaatgatgacgacgacgacgacgttattttagatgatcta
gtagaaagattttcgaaaccagcatctagccacgaagaaacttcaagcccacttgttatt
gactcttctgataatgaagaactcgagacggataaaccggctgataccaaactccatgct
tttgatcatactcagctcaataaaatcatacaagaccatgtacatattgattatgttact
ccacaaagatacaccgagcctgtagccaagagtccaggcactaaccagatctccagaatt
aatggcaatttagatttaaaaaataaagaagaaattgacaaatcattggatagtaccagc
ccattgaaacagaaacagcttgacgagaatgttgactattatgacgacgaaactatccac
cgtttagaaaatgaaccaactatcaatttcttaatgtcacctaattccaggccgttattt
tccattgaacaaatgaacaagatacaacaagagaatagtaaacgtaatgaggagttaatc
caggacataaagacccgtgatgacactattcagcttttaagtgaacaagtgaataagtta
cagggtaacttggttgaacaccaacaccaattgcgcgaattaaagaaaacaaatggtgaa
ttggtgaatatcgaacgagttctatctatccaattgaagcacaatgaacgcgaattagct
tctttaactaaaagcttcaagattaaagaaagttctgtatttcaattatcacaagagttg
tcaagaaaactgaatgagttaacacaagtggaatcacaatttacagatttgaccaacaaa
gttgaggaaattcaacatttaaaagatgatttgattgaaatgaatgatttgaatgaaaaa
tatgccaatcaaattgatagcttgattaaagaaagaaacgaaattcaaactcaaaatgac
gacttacaagggaaacttgagactgaatcgtcggaatggaaagataaatacgaacaattg
aatcaaacctatcaagaattaaaagatactaatgatgaattgaggaaccaattagatgat
gtatcgaccgatctcagcgaggccaatggtaaaaatgaggatttgaagacccatcttttg
aagtttgaaactgaagttgaacaattaacaactacaaatgaacaattgacaatggaaaaa
gaaaaattaacagcagcaaatcaagagaacgaaaagttgataaaggaatacgacgagatc
accaataatcgaattgcagacctagaacaagaacttgaagaaaccagacagaaggaggaa
cgagaaaaggagaattcaatccaattaggagcgcaacttgaggaattcaaacaacttaat
aaaaagctcgagtttaaaattgaagatttagattcagaagctgctttgttgaaagaggaa
ataacccgtcttgaaaccctagttaaagacaagactgcgcttgttgaagaaaaagatcaa
atcatttctgatgacatgatcaagttaaacgaattggtacaagctgtaaccgaatcaaga
gaacataataacgaagaagtcgaggatttgcataagcaaattgaaactctttcccgggac
catgccaaggaaatacaaagacttcaagaaaaacttgaaacgtctcaagcagaagcagat
caagaattcaatcgtcttgcccaatatttacatcatgaatattctgaaaaacatgcaaag
aaattgggtgaagttaaagttcattttgaacgagaacgagatggtctaattcgcgataaa
aaggcagctgaaagagaagcggagttgttaaagagaaaagtcaatcacatgaccagcgaa
atgaagaaaatgactgaaatttatgaaagtcaaacatccggatcacgacatagaagtcct
aataagtag

DBGET integrated database retrieval system