Streptococcus parasuis: KQ224_07700 Help Entry KQ224_07700       CDS       T07585                                  Symbol groES Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism spab  Streptococcus parasuis Brite KEGG Orthology (KO) [BR:spab00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:spab03110]     KQ224_07700 (groES)    03029 Mitochondrial biogenesis [BR:spab03029]     KQ224_07700 (groES) Chaperones and folding catalysts [BR:spab03110]  Heat shock proteins   HSP10    KQ224_07700 (groES) Mitochondrial biogenesis [BR:spab03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     KQ224_07700 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 FTP HupF_HypC Motif Other DBs NCBI-ProteinID:  QWV85936 LinkDB All DBs Position 1470485..1470766 Genome browser AA seq 93 aa AA seqDB search MLKPLGDRIVVKIEEKEQTVGGFVLAGASQEKTKEASVLAIGQGIRTLNGDLVAPAVAVG DTVLIDAHAGLEVKDGDQTVHIIREADVLAIVE NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttaaaaccattgggcgatcgtatcgttgtaaaaattgaagaaaaagaacaaactgtt ggtggctttgtcctagcaggcgcaagccaagaaaagacaaaagaagcaagtgtactagcg attggacaaggaattcgtaccttgaatggtgacttggttgccccagcggtagcagttgga gatactgttttgattgatgctcatgcaggcttggaagtcaaagacggtgaccagaccgtt cacatcattcgtgaagctgatgttttagcaatcgttgaataa

DBGET integrated database retrieval system