Streptomyces pactum: B1H29_02565 Help Entry B1H29_02565       CDS       T07142                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism spac  Streptomyces pactum Brite KEGG Orthology (KO) [BR:spac00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     B1H29_02565 Enzymes [BR:spac01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      B1H29_02565 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Glrx-like GST_N_3 Thioredoxin IU_nuc_hydro SH3BGR GST_N_2 DUF3203 Thioredoxin_7 Radical_SAM Motif Other DBs NCBI-ProteinID:  AQS71759 UniProt:  A0A1S6JJ53 LinkDB All DBs Position 586973..587212 Genome browser AA seq 79 aa AA seqDB search MVTVYSTTWCGYCDRLKKQLDRENIAYTEVDIETDPEAAQTVMKANGGNQVVPTVIFSDG TAMTNPGVLRIKQHLAKTA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggtcaccgtctactccaccacctggtgcggctactgcgaccgcctgaagaagcaactc gatcgcgagaacatcgcctacaccgaagttgacatcgaaaccgaccccgaagcggcacag accgtcatgaaggccaacggcggcaaccaggtcgtccccaccgtgatcttctccgacggc accgccatgaccaaccccggcgtcctccggatcaagcagcacctcgcgaagaccgcctga

DBGET integrated database retrieval system