Streptomyces pactum: B1H29_32030 Help Entry B1H29_32030       CDS       T07142                                  Name (GenBank) restriction endonuclease   KO K07448   restriction system protein Organism spac  Streptomyces pactum Brite KEGG Orthology (KO) [BR:spac00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02048 Prokaryotic defense system [BR:spac02048]     B1H29_32030 Prokaryotic defense system [BR:spac02048]  Restriction and modification system (R-M system)   Type IV R-M system    B1H29_32030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Mrr_cat Mrr_cat_2 Motif Other DBs NCBI-ProteinID:  AQS72354 UniProt:  A0A1S6JKR9 LinkDB All DBs Position 7345344..7345619 Genome browser AA seq 91 aa AA seqDB search MVIQCKRHAPTSAIASRELRDLLGARVHFGADLAVFVTTTRFSRPSEEFALRHGILAVHR DHLGVWNGGASLMSLADLNGAGQGDTRHRTR NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggtgatccagtgcaaacggcacgcgccgaccagcgcgatcgcgagccgtgagctgcgc gatctgctgggagcccgggtgcatttcggcgctgacctggccgtgttcgtgacgaccacg cggttcagccgcccgtccgaggagttcgcgttgcggcacgggattctcgccgtacatcgt gatcacctgggagtgtggaacgggggagcctccttgatgtcactcgccgatttgaacggt gccggccagggcgatacccggcatcggacacgctga

DBGET integrated database retrieval system