KEGG   Streptomyces paludis: DVK44_31020
Entry
DVK44_31020       CDS       T06964                                 
Name
(GenBank) RedV protein
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
spad  Streptomyces paludis
Pathway
spad00333  Prodigiosin biosynthesis
spad01100  Metabolic pathways
spad01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spad00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    DVK44_31020
SSDB
Motif
Pfam: Nitroreductase
Other DBs
NCBI-ProteinID: AXG83015
UniProt: A0A345I241
LinkDB
Position
7034283..7035476
AA seq 397 aa
MYEAAGIAALGPSSHNCQPWGVAWPTGRGARRAAERLVDEAHGGSAEAAARISGVTSADG
NETDEYVILALDRERELTSLPAHAVEMLISCGAYLQILLRALAAQGWSTDRVRFVEPLAG
ERRSGTRDACRSLGDTWPVSWSPLCVVRLRRTDEASGSLAGLRRTALARRTNRAPYRPDA
VEPAVLDGLCAPPAGAAEGADVTVRHLVADSEREVFAGFVARHGGRDFSHRQAWRETYSF
VRRDAAEAEERGDGFPLSQLFGPMPTPRRLALRVALAPTTMSVLRYAGYHRLLARQLARV
VRQTPAVVAMGFADPAPGVEATVRGGARLAEYWSRATDAGLVLHPVSVVLQHDDVRTELQ
DRLGLPGRTFFVSRLGRPLTDFPRSPRRTGARAVRTI
NT seq 1194 nt   +upstreamnt  +downstreamnt
ctgtacgaagcggccggcatcgccgcgctcggtccgtcgtcgcacaactgccagccctgg
ggcgtcgcatggcccaccggtcgcggcgcgcgccgggcggcggaacggctcgtcgacgaa
gcgcacggcggcagcgccgaggctgccgccaggatctccggtgtgaccagcgccgatgga
aacgaaacggacgagtatgtgatcctggccctcgaccgggagcgtgagctgacttccctt
cccgcgcacgccgtcgagatgctgatcagctgcggcgcgtacctccagatcctgttgcgc
gccctggccgcccagggatggtcgacggaccgcgtccgattcgtcgaaccactcgccggc
gaacggaggagcgggacccgtgacgcgtgccgctcgctcggtgacacctggccggtgtca
tggtcacccctgtgtgtcgtccggctgcgccgcacggacgaggcttccggttctctcgcc
gggctccgccgcaccgccctggcccgacggaccaaccgcgctccctaccgccccgacgcg
gtcgaaccagccgtcctggacggcctctgcgccccgccggcaggtgccgccgagggcgcg
gacgtcaccgtccggcatctcgtggccgacagcgaacgggaggtcttcgccggcttcgtg
gcccgccacgggggacgcgacttcagtcatcgacaggcttggcgcgaaacgtattccttc
gtgcgccgcgacgcggccgaggccgaggagcgtggcgacggctttcccctcagccaactg
ttcgggccgatgccgacgccccgtcgcctcgccctgcgcgtcgcgctggcccccaccacg
atgagtgtgctccggtacgcgggctaccaccgtctgctcgcccgccaactggcccgcgtc
gtcaggcagacgccggccgtcgtcgccatgggtttcgcggacccggcacccggcgtcgaa
gccaccgtccgcggcggagcccgcctcgctgagtactggtcgcgcgccacggatgcgggg
cttgtgctgcaccccgtcagcgtggtacttcagcacgacgacgtacgaacggagttgcag
gaccggctgggactgccgggccggaccttcttcgtgagcagattggggcgccctctcaca
gatttcccgcggtcaccacgtcggaccggtgcccgtgctgtccgcacgatctga

DBGET integrated database retrieval system