Sphingomonas panacisoli: FPZ24_09045 Help Entry FPZ24_09045       CDS       T07288                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spai  Sphingomonas panacisoli Pathway spai01100   Metabolic pathways spai01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spai00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FPZ24_09045    00074 Mycolic acid biosynthesis     FPZ24_09045   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FPZ24_09045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N PP-binding_2 DUF1493 DUF7080 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QDZ07617 UniProt:  A0A5B8LH56 LinkDB All DBs Position complement(1771851..1772087) Genome browser AA seq 78 aa AA seqDB search MSDTADRVKKIVVEHLGVEAASVTPEASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVNDAITYIDANQG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatactgccgaccgggtgaagaagatcgtggtcgagcatctgggcgtcgaagcc gcatcggtcacgcccgaagcgagcttcatcgacgatctcggtgccgacagcctcgacatc gtcgagctggtgatggcgttcgaggaagagttcggggtcgaaattccggacgacgccgcg gagaagatcacgaccgtcaacgacgcgatcacctatatcgacgcgaaccagggctga

DBGET integrated database retrieval system