Sphingomonas panacisoli: FPZ24_13270 Help Entry FPZ24_13270       CDS       T07288                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism spai  Sphingomonas panacisoli Pathway spai00190   Oxidative phosphorylation spai01100   Metabolic pathways Module spai_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:spai00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     FPZ24_13270  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:spai00194]     FPZ24_13270 Photosynthesis proteins [BR:spai00194]  Photosystem and electron transport system   F-type ATPase [OT]    FPZ24_13270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF5671 Motif Other DBs NCBI-ProteinID:  QDZ08329 UniProt:  A0A5B8LK90 LinkDB All DBs Position complement(2670055..2670285) Genome browser AA seq 76 aa AA seqDB search MDHTSAMYLGAGLAAIGVGMAAIGVGNVFGSFLEGALRNPSAADGQQGRLFIGFAAAELL GLIAFVVAILILFVVK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggaccatacttctgcaatgtacctgggtgccggtctcgccgcgatcggcgtcggcatg gccgccatcggcgtgggcaacgtcttcggctcgttcctcgagggcgcgctgcgcaatccg tcggccgccgacggtcagcagggccgcctgttcatcggcttcgccgccgccgaacttctg ggcctgatcgcgttcgtcgtcgcgatcctcatcctgttcgtcgtcaagtaa

DBGET integrated database retrieval system