Sulfurimonas paralvinellae: FM071_02085 Help Entry FM071_02085       CDS       T06862                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spal  Sulfurimonas paralvinellae Pathway spal01100   Metabolic pathways spal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spal00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FM071_02085 (acpP)    00074 Mycolic acid biosynthesis     FM071_02085 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FM071_02085 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 Ribosomal_L12_N DUF5783 PRD Motif Other DBs NCBI-ProteinID:  QOP45144 UniProt:  A0A7M1B5Z8 LinkDB All DBs Position 380350..380577 Genome browser AA seq 75 aa AA seqDB search MALLDDIKEVVVEQLSVSPDEVKEDSKFVEDLGADSLDVVELVMALEEKFDIEIPDDEAE KIQTVQDVVNYIENK NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcacttttagacgatattaaagaagtagtagttgaacaactaagcgtgagcccagat gaggtgaaagaagattcaaaatttgtagaagatttaggtgcagatagccttgatgttgta gaattagtaatggctcttgaagaaaaattcgatatcgaaattcctgatgatgaagctgaa aagattcaaacagttcaagacgttgttaactatatagaaaacaaatag

DBGET integrated database retrieval system