Sphingomonas panacis: AWL63_11415 Help Entry AWL63_11415       CDS       T04760                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism span  Sphingomonas panacis Pathway span01100   Metabolic pathways span01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:span00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AWL63_11415    00074 Mycolic acid biosynthesis     AWL63_11415   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AWL63_11415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AOH86710 UniProt:  A0A1B3ZGZ6 LinkDB All DBs Position complement(2545976..2546179) Genome browser AA seq 67 aa AA seqDB search MCDVFDLDELDYSDGLSAEVIEEWDSLSHIRFIVAVEKRFGFRFSSAEIEGFSKVGDLVD SIAAHIG NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgtgcgatgtcttcgacctcgacgaactcgactattccgatggcctctccgccgaggtg atcgaggaatgggacagcctcagccacatccgcttcatcgtcgcggtcgagaagcgcttc ggcttccgcttctccagcgccgagatcgagggcttttcgaaggtcggcgatctcgtcgac agcatcgccgcgcatattggctga

DBGET integrated database retrieval system