Sphingomonas panacis: AWL63_17005 Help Entry AWL63_17005       CDS       T04760                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism span  Sphingomonas panacis Pathway span01100   Metabolic pathways span01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:span00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AWL63_17005    00074 Mycolic acid biosynthesis     AWL63_17005   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AWL63_17005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AOH85389 UniProt:  A0A1B3ZD87 LinkDB All DBs Position 3793860..3794132 Genome browser AA seq 90 aa AA seqDB search MLPDDNSTIETTVRAVLRDVLGLSEARAAALRDDTLLFGAMPELDSMAVAGVLTELEERL GILIEDDEVDGEMLETFGALVRFAAAKAPR NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgttgccagacgataattcgacgatcgagacgaccgtgcgcgcggtgttgcgcgacgtg ctggggctgagcgaagcgcgcgcggccgccttgcgcgacgacacgttgctgttcggcgcg atgccggaactcgattcgatggcggtcgcgggcgtgctcaccgaactggaagagcggctc ggcatcctgatcgaagacgacgaagtcgacggcgaaatgctcgagaccttcggcgcgctc gtccggttcgcggcggccaaagcgccgcgatga

DBGET integrated database retrieval system