Sphingomonas panacis: AWL63_18645 Help Entry AWL63_18645       CDS       T04760                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism span  Sphingomonas panacis Brite KEGG Orthology (KO) [BR:span00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:span03032]     AWL63_18645    03036 Chromosome and associated proteins [BR:span03036]     AWL63_18645    03400 DNA repair and recombination proteins [BR:span03400]     AWL63_18645 DNA replication proteins [BR:span03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AWL63_18645 Chromosome and associated proteins [BR:span03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AWL63_18645 DNA repair and recombination proteins [BR:span03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AWL63_18645 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AOH85656 UniProt:  A0A1B3ZE06 LinkDB All DBs Position 4131589..4131858 Genome browser AA seq 89 aa AA seqDB search MNIGELAKGAAAAMSTSEANAKSAITAVFDQIAAAAAKGEEIAIPGFGKFSVRDRPERQG RNPATGEAMTIAASKKVSFAAAKGLKDKL NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaatatcggtgaactggcaaaaggtgccgctgcggcgatgagcacaagcgaagcgaac gccaagtctgcgataacggccgtgttcgatcagattgccgctgcggccgccaagggcgaa gaaatagcgatccccggcttcggcaagttttccgtcagggatcgacccgagcgtcagggc cgcaatccggcgactggtgaggcgatgaccatcgcggcgtcgaagaaggtgtcgttcgcc gccgcaaaggggctaaaagacaagctctga

DBGET integrated database retrieval system