KEGG   Saccharomyces paradoxus: SPAR_G03280
Entry
SPAR_G03280       CDS       T08193                                 
Name
(RefSeq) Clb1
  KO
K02220  G2/mitotic-specific cyclin 1
Organism
spao  Saccharomyces paradoxus
Pathway
spao04011  MAPK signaling pathway - yeast
spao04111  Cell cycle - yeast
spao04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:spao00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    SPAR_G03280
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    SPAR_G03280
   04113 Meiosis - yeast
    SPAR_G03280
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 54630722
NCBI-ProteinID: XP_033766450
UniProt: A0A8B8URN4
LinkDB
Position
VII:690020..691438
AA seq 472 aa
MSRSLLVENSRTINSNEENGINESQYILQKRNVPRTILGNVTNNANILQEISMNKKIGMK
GFSKLSSFFPLKDEVSRADDFTSSFNDSRQGGKQEVLNNKENIPEYGYSKQKKQQQCSND
DSLHTNSTTLNRNRLVYSENKSFSTQIEWQKKSVREDSKKKRPISTLVEQDDQKKFKLHE
FTTEEEILEEYEWDDLDEEDFDDPLMVSEDVNDIFDYLHHLEIITLPNKANLYKHKNIKQ
NRDILVNWIIKIHNKFGLLPETLYLAINIMDRFLCEEVVQLNRLQLVGTSCLFIASKYEE
IYSPSIKHFAYETDGACSVEEIKEGERFILEKLDFQISFANPMNFLRRISKADDYDIQSR
TLAKFLMEISIVDFKFIGILPSLCASAAMFLSRKMLGKGSWDGNLIHYSGGYTKAKLYPV
CQLLMDYLVGSAIHDEFLKKYQSRRFLKASIISIEWALKVRKNGYDIMTLHE
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgtcaagatcacttttggtagagaatagtagaacgattaatagtaatgaagagaatggt
ataaacgaaagtcaatatattttacaaaagagaaacgttccaagaacaattctcggtaat
gtcacgaacaatgcaaatatcctgcaggagatctctatgaacaaaaaaatcggaatgaag
ggcttctcgaaattgagctctttcttccccttgaaggacgaggtttcgagagccgacgat
tttacctcctcttttaatgatagtagacagggagggaaacaagaggtgttaaacaataag
gaaaatatccctgaatatggatattcaaagcagaaaaagcagcagcagtgttcaaacgat
gactctcttcatacgaattcaactaccttgaaccgtaatcggttggtatattccgagaac
aaatcgttttctacccaaatcgaatggcagaaaaaaagtgtgagagaagattccaaaaaa
aaaagaccaatatcaactcttgtagagcaagatgaccaaaaaaagtttaaattacatgag
tttactacagaagaagagattctggaggaatatgaatgggatgatttagacgaagaagat
tttgatgatccgttaatggtgagcgaagacgttaatgatatctttgattacctacaccac
ttagaaataatcacattaccaaataaggcaaatctctataagcataagaacattaaacag
aacagagacatcttggtgaattggataatcaagattcataataagtttgggctcctgccg
gaaactttatatttggccataaacataatggatagatttctttgtgaagaggtggtacaa
ttaaatagattacaactggttggtacatcatgcttgttcatcgcctctaaatatgaggaa
atttactctccaagcataaaacatttcgcgtacgagacagacggtgcatgctctgtggaa
gaaattaaggaaggtgaaagatttatattggaaaaactagactttcaaattagtttcgct
aatccaatgaatttcttaaggagaatatcaaaggcggatgactatgatattcagtctagg
acgttagcaaagttcttaatggaaatatctatagtggatttcaagttcattgggatatta
ccatcattatgcgcctcggcggcgatgttcctctcgagaaaaatgctaggtaaaggcagc
tgggatggtaatttgattcactatagtggtggttacacaaaggcaaaactatatcccgtt
tgccaactattgatggattatcttgtcggatccgccattcatgacgagttcttaaagaaa
tatcagtcgagaagatttttaaaggcttccataatttctatcgaatgggcattgaaagta
aggaagaatgggtatgatattatgactttgcatgagtga

DBGET integrated database retrieval system