Saccharomyces paradoxus: SPAR_O00670 Help Entry SPAR_O00670       CDS       T08193                                  Name (RefSeq) uncharacterized protein   KO K11511   centromere protein S Organism spao  Saccharomyces paradoxus Pathway spao03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:spao00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     SPAR_O00670  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:spao03036]     SPAR_O00670    03400 DNA repair and recombination proteins [BR:spao03400]     SPAR_O00670 Chromosome and associated proteins [BR:spao03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      SPAR_O00670 DNA repair and recombination proteins [BR:spao03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      SPAR_O00670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C Bromo_TP TFIID-31kDa Motif Other DBs NCBI-GeneID:  54633496 NCBI-ProteinID:  XP_033769071 UniProt:  A0A8B8UZC8 LinkDB All DBs Position XV:144600..144875 Genome browser AA seq 91 aa AA seqDB search MNDDGDRPQLKARLWVHVEERLQQVLSSEDVKYTPKFINSLLELAYLQLGEMGSDLQAFA EHAGRDVVNDSDLMLYLRKQPDLQEKVIQEE NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaatgacgatggagatagacctcaattgaaagccaggctgtgggttcacgtggaagaa cgactacaacaggtgttgtcttctgaggacgtgaaatacacaccgaaattcatcaactca ttgctagagttagcatatctacaattgggtgagatggggagcgatttgcaggcatttgct gagcatgctggtagggatgtggtcaacgacagtgacctcatgctgtatttgaggaagcag ccagacttgcaagaaaaagtcattcaagaggaatga

DBGET integrated database retrieval system