Saccharomyces paradoxus: SPAR_O01430 Help Entry SPAR_O01430       CDS       T08193                                  Name (RefSeq) Rpb11   KO K03008   DNA-directed RNA polymerase II subunit RPB11 Organism spao  Saccharomyces paradoxus Pathway spao03020   RNA polymerase spao03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:spao00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     SPAR_O01430   09124 Replication and repair    03420 Nucleotide excision repair     SPAR_O01430  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:spao03021]     SPAR_O01430    03400 DNA repair and recombination proteins [BR:spao03400]     SPAR_O01430 Transcription machinery [BR:spao03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Core subunits      SPAR_O01430 DNA repair and recombination proteins [BR:spao03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       SPAR_O01430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_L_2 RNA_pol_L Motif Other DBs NCBI-GeneID:  54633572 NCBI-ProteinID:  XP_033769147 UniProt:  A0A8B8UZF5 LinkDB All DBs Position XV:complement(307195..307557) Genome browser AA seq 120 aa AA seqDB search MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgaatgctccagacagattcgaactgttccttctgggtgaaggcgagtccaagctgaag atcgacccggacaccaaagcccccaacgcagtagtgataacattcgagaaggaggatcac acgctgggcaacctgattcgcgcagagcttctgaacgacagaaaagtgctatttgccgcc tataaggtcgagcatcccttcttcgctcggttcaagctgagaatacagaccaccgagggc tacgatccaaaggacgccttgaaaaacgcctgtaatagcatcattaacaagcttggcgct ctgaagacgaatttcgaaaccgagtggaacctgcaaactctggccgccgacgacgcattc taa

DBGET integrated database retrieval system