KEGG   Stenotrophomonas pavanii: STNY_R18580
Entry
STNY_R18580       CDS       T07567                                 
Symbol
thrC
Name
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
spaq  Stenotrophomonas pavanii
Pathway
spaq00260  Glycine, serine and threonine metabolism
spaq00750  Vitamin B6 metabolism
spaq01100  Metabolic pathways
spaq01110  Biosynthesis of secondary metabolites
spaq01120  Microbial metabolism in diverse environments
spaq01230  Biosynthesis of amino acids
Module
spaq_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:spaq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STNY_R18580 (thrC)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    STNY_R18580 (thrC)
Enzymes [BR:spaq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     STNY_R18580 (thrC)
SSDB
Motif
Pfam: PALP Thr_synth_N THR4_C
Other DBs
NCBI-ProteinID: BCX43659
UniProt: A0ABM7R324
LinkDB
Position
2007376..2008662
AA seq 428 aa
MHFVSTRGQAPAVGLSAAIAAGLAPDGGLYVPATLPAARELQAGATLADTAADLLAPFFA
ADALEAALPSICREAFDFPVPLRALGNGDHVLELFHGPTAAFKDIGARFLAGTLSRLQAG
KDRDLTIVVATSGDTGAAVAAAFHRQPGVRVVVLYPDGRVSPRQAHQLGCFGDNIQALRV
AGAFDDCQAMVKQALADRDLQAQVPLSSANSISLGRLLPQMSYYAHAALTHYAAHRRRLN
LVVPTGNLGNAMAAVLARALGVPIGQIVLATNANAVLPAYFNGGDYQPQASVATVANAMD
VGAPSNFERLRWLYHGDDAELRAAFRAFAVDDVTIRATIAAAHASSGELFCPHTATAVKV
LQDLRARGAKGDWAVVATAHPAKFEAVVEPLIGGPVAVPPALDALLQRPAHAEPLAADYA
ALREVLMR
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgcactttgtttcgacccgcggccaagctccggccgttggcctcagcgccgcgatcgct
gcaggattggcacccgacggcgggctgtatgtgcccgccaccctgccggcggcacgtgag
ctgcaggccggggcgacgctggccgataccgccgcggacctgctggcaccgttcttcgcc
gctgacgcgctcgaggccgcgttgccgtcgatctgccgcgaggcgttcgacttcccggtg
ccgctgcgtgcacttggcaacggcgaccatgtgctggagctgttccatgggccgacggcg
gcgttcaaggacatcggcgcgcgtttcctggccggaacgctgtcgcggctgcaggccggc
aaggaccgcgacctgacgatcgttgtcgccacctctggcgataccggtgccgccgtggcg
gcagccttccatcgccagccgggcgtgcgtgtggtggtgctgtacccggatggccgcgtg
tcaccgcggcaggcgcatcagcttggctgcttcggcgacaacatccaggcgctgcgtgtg
gccggggcgtttgacgattgccaggccatggtcaagcaggcgctggccgaccgtgacctg
caggcgcaggtgccgctcagctcggccaacagcatcagcctcggccgcctgctccctcag
atgagttactacgcacatgcggcgttgacccactacgcagcgcatcgtcgtcggctcaat
ctggtggtgccgaccggcaatctgggcaatgcgatggccgcagtgctggcgcgcgcgctg
ggcgttccgatcgggcagatcgtgctggcgaccaatgccaatgcggtgctgccggcgtac
ttcaacggtggcgactatcagccgcaggccagtgtggccacggttgccaacgcaatggat
gtgggggcgccaagcaacttcgagcgcctgcgctggctctatcacggtgatgatgccgag
ctgcgcgccgccttccgcgcgttcgcggtggatgacgtgaccatccgcgcgacaattgcg
gccgcgcatgccagtagtggcgagctgttctgcccgcacacggcgacggcggtgaaggtg
ttgcaggacctgcgcgcgcgcggtgccaagggcgactgggcggtggtggccacggcgcat
ccggccaagttcgaggcggtggtggagccgttgatcggcggcccggtcgcggtgccgccg
gcattggacgcgttgctgcagcgaccggcgcatgccgagccattggcggccgattacgcg
gcgttgcgtgaggtgttgatgcgttga

DBGET integrated database retrieval system