Stenotrophomonas pavanii: STNY_R41100 Help Entry STNY_R41100       CDS       T07567                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spaq  Stenotrophomonas pavanii Pathway spaq01100   Metabolic pathways spaq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spaq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     STNY_R41100    00074 Mycolic acid biosynthesis     STNY_R41100   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     STNY_R41100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BCX45885 LinkDB All DBs Position complement(4467986..4468243) Genome browser AA seq 85 aa AA seqDB search MQALEHEIKELIISSLSLEDITPEDIDPTAPLFVEGLGLDSIDALELGLALQKKYGVSLS ADSEETRRHFSSVRALGEFVAARQS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgcaagcacttgagcacgagatcaaggaattgatcatttcctccctttcgctggaggac atcacgccggaggacatcgatccgaccgcgccgctgttcgtcgagggcctcggcctggat tcgatcgacgcgctggagctgggcctggcactgcagaagaagtacggtgtcagcctgtcg gccgattcggaagaaacccgtcgccatttctccagcgtgcgcgcgctcggcgagttcgtc gccgcccgccagtcgtaa

DBGET integrated database retrieval system