Saprolegnia parasitica: SPRG_01868 Help Entry SPRG_01868        CDS       T04137                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism spar  Saprolegnia parasitica Pathway spar04814   Motor proteins Brite KEGG Orthology (KO) [BR:spar00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     SPRG_01868  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:spar03037]     SPRG_01868    04812 Cytoskeleton proteins [BR:spar04812]     SPRG_01868 Cilium and associated proteins [BR:spar03037]  Motile cilia and associated proteins   Dynein arm    SPRG_01868 Cytoskeleton proteins [BR:spar04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      SPRG_01868 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  24124446 NCBI-ProteinID:  XP_012195824 UniProt:  A0A067CRB1 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MAPPTDIAPEGAVKERRDPKITLMRVEMTTAMKDEAISHLAESLVTNVIEKDIATDMKKY FDQKYGPTWHCIVGKGFGCSIAYDTQFLLFFKMDQHYLLLFKSTE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggcgccaccgacggatattgcacctgaaggggcagtgaaggagcgccgggaccccaag atcaccctgatgcgggtcgagatgacgaccgcgatgaaggacgaagccatctcgcacctc gccgagagcctcgtgaccaacgtcatcgagaaggacattgcgacagacatgaaaaagtac tttgaccaaaagtacggacctacgtggcactgcatcgtcgggaaaggcttcggctgctcg attgcgtacgacacgcagttcctcctcttcttcaagatggaccagcactacctgctcctc ttcaagtccaccgagtag

DBGET integrated database retrieval system