Saprolegnia parasitica: SPRG_04017 Help Entry SPRG_04017        CDS       T04137                                  Name (RefSeq) hypothetical protein   KO K02183   calmodulin Organism spar  Saprolegnia parasitica Pathway spar04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:spar00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     SPRG_04017  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:spar01009]     SPRG_04017   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:spar04131]     SPRG_04017    03036 Chromosome and associated proteins [BR:spar03036]     SPRG_04017   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:spar04147]     SPRG_04017 Protein phosphatases and associated proteins [BR:spar01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      SPRG_04017 Membrane trafficking [BR:spar04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     SPRG_04017 Chromosome and associated proteins [BR:spar03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      SPRG_04017 Exosome [BR:spar04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    SPRG_04017 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 EH DUF5580_M Pre_tape_measure Motif Other DBs NCBI-GeneID:  24126490 NCBI-ProteinID:  XP_012197997 UniProt:  A0A067CQ74 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search MALSLEHEQELRKVFDDYDEDGTGDIDAEELGKIAEDLGEPLSKEELEYLIMEFDADGSG TIDWEEFIAWWKVPF NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcgctgtcgctagagcacgagcaagagctgcgcaaggtcttcgacgactacgacgag gacgggaccggcgacattgacgccgaagaactcggcaagatcgccgaagacctcggcgag ccgctctccaaggaagagctcgagtacctcatcatggagtttgacgctgatggcagtggc acgatcgactgggaagagttcattgcgtggtggaaggtgccattttaa

DBGET integrated database retrieval system