Saprolegnia parasitica: SPRG_05777 Help Entry SPRG_05777        CDS       T04137                                  Name (RefSeq) hypothetical protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism spar  Saprolegnia parasitica Pathway spar03020   RNA polymerase spar03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:spar00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     SPRG_05777   09124 Replication and repair    03420 Nucleotide excision repair     SPRG_05777  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:spar03021]     SPRG_05777    03400 DNA repair and recombination proteins [BR:spar03400]     SPRG_05777 Transcription machinery [BR:spar03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      SPRG_05777   RNA polymerase III system    RNA polymerase III      SPRG_05777   RNA polymerase I system    RNA polymerase I      SPRG_05777 DNA repair and recombination proteins [BR:spar03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       SPRG_05777 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-GeneID:  24128159 NCBI-ProteinID:  XP_012200450 UniProt:  A0A067CQU5 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MDDEYDHDAAMDDMEDVNEEQEEMENFDEMEDGAEHENGVALLDESEKQPNAHRITTRYM TQISMNAPVMVDIEGETDPLKIAMKELSQRKIPIIIRRYLPDGSYEDWSIDELIIE NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggacgacgagtacgaccacgacgccgccatggacgacatggaggacgtgaacgaggag caggaagagatggagaacttcgacgagatggaagacggcgccgagcatgagaacggcgtc gcgctcctcgacgagtcggagaagcagcccaacgcccaccgcatcacgacgcgctacatg acccaaatcagcatgaacgcgcccgtcatggtcgacattgaaggcgagacggacccgctc aagattgccatgaaggagctcagccagcgcaagatcccgatcatcatccgccggtacctc ccggatggctcgtacgaggactggtccattgacgaactcattattgaataa

DBGET integrated database retrieval system