Saprolegnia parasitica: SPRG_05883 Help Entry SPRG_05883        CDS       T04137                                  Name (RefSeq) hypothetical protein   KO K10419   dynein light chain roadblock-type Organism spar  Saprolegnia parasitica Pathway spar04814   Motor proteins Brite KEGG Orthology (KO) [BR:spar00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     SPRG_05883  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:spar04131]     SPRG_05883   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:spar03037]     SPRG_05883    04812 Cytoskeleton proteins [BR:spar04812]     SPRG_05883 Membrane trafficking [BR:spar04131]  Endosome - Golgi transport   Rab GTPases and associated proteins    Rab associated proteins     SPRG_05883 Cilium and associated proteins [BR:spar03037]  Motile cilia and associated proteins   Dynein arm    SPRG_05883 Cytoskeleton proteins [BR:spar04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      SPRG_05883 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Robl_LC7 LAMTOR5 CHASE8 dCache_3 Motif Other DBs NCBI-GeneID:  24128257 NCBI-ProteinID:  XP_012199850 UniProt:  A0A067CRA9 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MSEVEETLERIKNHKGVEGYVIADKNGAVLRRHPHMDTASAERYSSFMKELTTKARGVVR DLNPKNDLQYLRIRLKKFEILVAHEKEFLVIVIQKWSPNAT NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgtcggaggttgaagagacgctcgagcgcatcaagaaccacaagggcgtcgaaggctac gtgattgcggacaagaacggtgctgtgctgcgccgccatccgcacatggacacggcgagc gccgagcgctactcgagcttcatgaaggagctcacgaccaaggcgcggggcgtcgtgcgc gacctcaaccccaagaacgacctgcagtacctccgcattcgcctcaagaagttcgagatc ctcgtcgcccatgagaaggagtttctcgtgattgtgatccagaaatggtcgcccaatgca acataa

DBGET integrated database retrieval system