Saprolegnia parasitica: SPRG_07596 Help Entry SPRG_07596        CDS       T04137                                  Name (RefSeq) Ras-like protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism spar  Saprolegnia parasitica Pathway spar04145   Phagosome spar04148   Efferocytosis spar04620   Toll-like receptor signaling pathway spar05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:spar00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     SPRG_07596    04148 Efferocytosis     SPRG_07596  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     SPRG_07596  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     SPRG_07596  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:spar04131]     SPRG_07596   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:spar04147]     SPRG_07596    04031 GTP-binding proteins [BR:spar04031]     SPRG_07596 Membrane trafficking [BR:spar04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     SPRG_07596  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     SPRG_07596   Macropinocytosis    Ras GTPases     SPRG_07596  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     SPRG_07596 Exosome [BR:spar04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    SPRG_07596   Exosomal proteins of other body fluids (saliva and urine)    SPRG_07596   Exosomal proteins of colorectal cancer cells    SPRG_07596   Exosomal proteins of bladder cancer cells    SPRG_07596 GTP-binding proteins [BR:spar04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     SPRG_07596 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  24129860 NCBI-ProteinID:  XP_012202272 UniProt:  A0A067CJ94 LinkDB All DBs Position Unknown AA seq 195 aa AA seqDB search MNMQNMKCVVVGDGAVGKTCVLISYTTNAFPGEYIPTVFDNYSANVMVDAKPVNLGLWDT AGQEDYDRLRPLSYPQTDVFLICFSVVSPASFENVKAKWYPEIQHHAPGVPFILVGTKLD LREDEDTVERLKEKRSAPVTHEMGEALKNELGAFKYLECSALTQKGLKQVFDESIRCVLQ HQKNPKKKRSHCTIL NT seq 588 nt NT seq  +upstreamnt  +downstreamnt atgaacatgcagaacatgaagtgcgtggtcgtcggcgacggcgccgtcggcaagacgtgc gtgctcatctcgtacacgaccaacgcgttcccgggcgagtacatcccgacggtcttcgac aactacagcgccaacgtcatggtcgacgccaagcccgtgaacctcgggctctgggacacg gccggccaagaagactacgaccgcctgcggccgctgagctacccgcagaccgacgtgttt ctgatctgctttagcgtcgtgagcccggcctcgttcgagaacgtcaaggcgaaatggtac ccggagatccagcaccacgcgcctggcgtgccgttcattctcgttggcaccaagctcgac ttgcgcgaagacgaagacacggtcgagcgcctgaaggagaagcggtcggcgcccgtcaca cacgagatgggcgaggcgctcaagaacgagctcggcgcgttcaagtacctcgagtgctcg gcgctgacgcagaagggcctcaagcaggtgtttgacgagagcatccgctgcgtcctccag caccagaagaacccaaagaagaagcgcagccactgcacgatcctatag

DBGET integrated database retrieval system