Saprolegnia parasitica: SPRG_07688 Help Entry SPRG_07688        CDS       T04137                                  Name (RefSeq) DNA-directed RNA polymerase I   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism spar  Saprolegnia parasitica Pathway spar03020   RNA polymerase spar03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:spar00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     SPRG_07688   09124 Replication and repair    03420 Nucleotide excision repair     SPRG_07688  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:spar03021]     SPRG_07688    03400 DNA repair and recombination proteins [BR:spar03400]     SPRG_07688 Transcription machinery [BR:spar03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      SPRG_07688   RNA polymerase III system    RNA polymerase III      SPRG_07688   RNA polymerase I system    RNA polymerase I      SPRG_07688 DNA repair and recombination proteins [BR:spar03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       SPRG_07688 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N Chordopox_RPO7 Motif Other DBs NCBI-GeneID:  24129944 NCBI-ProteinID:  XP_012202356 UniProt:  A0A067CCR0 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIVPVRCFTCGKVLANKWETYLSLLRSDYTEGDALDELSLKRYCCRRMMLTHVDLIEKLL HYNTGAIERGADD NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgtccccgtgcgctgcttcacgtgcggcaaggtgctcgccaacaagtgggaaacg tacctcagcctcctgcgctccgactacacggaaggcgacgctctcgacgagctctcgctc aagcgctactgctgccgccgcatgatgctcacgcacgtggacctcattgagaagctgctg cactacaacacgggcgccatcgaacggggcgccgacgactaa

DBGET integrated database retrieval system