Saprolegnia parasitica: SPRG_10819 Help Entry SPRG_10819        CDS       T04137                                  Name (RefSeq) hypothetical protein   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism spar  Saprolegnia parasitica Pathway spar03010   Ribosome spar04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:spar00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     SPRG_10819   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     SPRG_10819  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:spar03011]     SPRG_10819    04121 Ubiquitin system [BR:spar04121]     SPRG_10819 Ribosome [BR:spar03011]  Ribosomal proteins   Eukaryotes    Large subunit     SPRG_10819   Archaea     SPRG_10819 Ubiquitin system [BR:spar04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    SPRG_10819 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L40e Motif Other DBs NCBI-GeneID:  24132906 NCBI-ProteinID:  XP_012205169 UniProt:  A0A067CBV7 LinkDB All DBs Position Unknown AA seq 56 aa AA seqDB search MDDMAIEPTLAALAKKTNCEKQICRVCYARLPPRATNCRKKKCGHSNQLRIKKKIK NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atggacgacatggctattgaacccacccttgccgctttggccaagaagacgaactgcgaa aagcagatctgccgtgtgtgctacgcgcgcctcccgccgcgtgccaccaactgccgcaag aagaagtgcgggcactcgaaccagctccgcatcaagaagaagatcaagtaa

DBGET integrated database retrieval system