Saprolegnia parasitica: SPRG_15029 Help Entry SPRG_15029        CDS       T04137                                  Name (RefSeq) hypothetical protein   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism spar  Saprolegnia parasitica Pathway spar03010   Ribosome spar04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:spar00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     SPRG_15029   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     SPRG_15029  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:spar03011]     SPRG_15029    04121 Ubiquitin system [BR:spar04121]     SPRG_15029 Ribosome [BR:spar03011]  Ribosomal proteins   Eukaryotes    Large subunit     SPRG_15029   Archaea     SPRG_15029 Ubiquitin system [BR:spar04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    SPRG_15029 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L40e Motif Other DBs NCBI-GeneID:  24136800 NCBI-ProteinID:  XP_012210188 UniProt:  A0A067BXT0 LinkDB All DBs Position Unknown AA seq 64 aa AA seqDB search MLLQEEEADSKMAIEPTLAALAKKTNCEKQICRVCYARLPPRATNCRKKKCGHSNQLRIK KKIK NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgttgcttcaagaggaagaggccgactccaagatggctattgaacccacccttgccgct ttggccaagaagacgaactgcgaaaagcagatctgccgtgtgtgctacgcgcgccttccg ccgcgtgccaccaactgccgcaagaagaagtgcgggcactcgaaccagctccgcatcaag aagaagatcaagtaa

DBGET integrated database retrieval system