Saprolegnia parasitica: SPRG_15839 Help Entry SPRG_15839        CDS       T04137                                  Name (RefSeq) hypothetical protein   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism spar  Saprolegnia parasitica Pathway spar03018   RNA degradation spar03040   Spliceosome Brite KEGG Orthology (KO) [BR:spar00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     SPRG_15839   09123 Folding, sorting and degradation    03018 RNA degradation     SPRG_15839  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:spar03019]     SPRG_15839    03041 Spliceosome [BR:spar03041]     SPRG_15839 Messenger RNA biogenesis [BR:spar03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      SPRG_15839   mRNA degradation factors    5'-3' decay     Lsm complex      SPRG_15839 Spliceosome [BR:spar03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     SPRG_15839 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM DUF150_C Motif Other DBs NCBI-GeneID:  24137523 NCBI-ProteinID:  XP_012210408 UniProt:  A0A067BWA6 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MASKRDPILDLAKFIDQSVRIKFAGGREVTGVLKGYDQLVNLVLDEAVEYFETPGETRNL GLLVCRGTSVMLISPVDGTQELYSNPFLPEE NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggcatcgaagcgcgacccgattctggacttggccaagttcatcgaccagagcgtgcgc atcaagttcgccggcggccgcgaagtcacgggcgtcctcaagggctacgaccagctcgtg aacctcgtgctcgacgaggccgtcgagtacttcgagacgcctggcgagacgcgcaacctc ggtctcctcgtctgccgagggacatcggtcatgctcatctcgcccgtcgatggcacgcaa gagctctattcgaacccgttcctgcccgaagagtag

DBGET integrated database retrieval system