Saprolegnia parasitica: SPRG_16013 Help Entry SPRG_16013        CDS       T04137                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism spar  Saprolegnia parasitica Pathway spar04814   Motor proteins Brite KEGG Orthology (KO) [BR:spar00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     SPRG_16013  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:spar03037]     SPRG_16013    04812 Cytoskeleton proteins [BR:spar04812]     SPRG_16013 Cilium and associated proteins [BR:spar03037]  Motile cilia and associated proteins   Dynein arm    SPRG_16013 Cytoskeleton proteins [BR:spar04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      SPRG_16013 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light COOH-NH2_lig DUF4854 ApoO Motif Other DBs NCBI-GeneID:  24137679 NCBI-ProteinID:  XP_012210707 UniProt:  A0A067BJI2 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MSKAAAKKDDVSVGALRIAHRDSSTEMEDFLIASATNALKAYYKGEKNHFTEVAQQIKKE IEETHDGSWHVIVGKSFGSFVTHEVKKLLYFFLGQIGFLIFRHG NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgtcgaaagccgcggccaagaaggacgacgtgagcgtcggcgcgttgcgcatcgcgcat cgggacagcagcaccgagatggaagacttcctcatcgcaagcgccacgaacgcgctcaag gcgtactacaagggtgagaagaatcactttaccgaagtcgcgcagcagatcaagaaagag atcgaagagacccacgacgggagctggcacgtcattgtcggcaaatcctttggctcgttc gtgacgcacgaagtcaaaaagctcctctactttttcctgggccaaatcggctttctcatc tttcgccatggttaa

DBGET integrated database retrieval system