Saprolegnia parasitica: SPRG_17334 Help Entry SPRG_17334        CDS       T04137                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism spar  Saprolegnia parasitica Pathway spar04814   Motor proteins Brite KEGG Orthology (KO) [BR:spar00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     SPRG_17334  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:spar03037]     SPRG_17334    04812 Cytoskeleton proteins [BR:spar04812]     SPRG_17334 Cilium and associated proteins [BR:spar03037]  Motile cilia and associated proteins   Dynein arm    SPRG_17334 Cytoskeleton proteins [BR:spar04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      SPRG_17334 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  24138879 NCBI-ProteinID:  XP_012212052 UniProt:  A0A067BKK9 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MGEAPSWQHMWGARVKTPCDMEDDVLEDVIKHTTSRLGQFDTEEWEKHGLAVCDEIRDHL DKAWDPSWVVCVGRNFGSYVTHVTRNFVYFYYNEKAILIYKAG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgggcgaagcgccgagctggcagcacatgtggggcgcgcgggtcaagacgccgtgcgac atggaagacgacgtgctcgaagacgtgatcaagcacacgacgtcgcgcctcgggcagttc gacacggaggagtgggagaagcacgggctcgccgtctgcgacgagatccgcgaccacctc gacaaggcgtgggacccgtcgtgggtcgtctgcgttggccgcaactttggctcgtacgtc acgcacgtcacgcgcaacttcgtctacttttactacaacgaaaaggccatattgatctac aaggcgggctaa

DBGET integrated database retrieval system