Saprolegnia parasitica: SPRG_19989 Help Entry SPRG_19989        CDS       T04137                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism spar  Saprolegnia parasitica Pathway spar04145   Phagocytosis spar04517   IgSF CAM signaling spar04814   Motor proteins Brite KEGG Orthology (KO) [BR:spar00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     SPRG_19989  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     SPRG_19989   09142 Cell motility    04814 Motor proteins     SPRG_19989  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:spar03037]     SPRG_19989    04812 Cytoskeleton proteins [BR:spar04812]     SPRG_19989 Cilium and associated proteins [BR:spar03037]  Motile cilia and associated proteins   Dynein arm    SPRG_19989 Cytoskeleton proteins [BR:spar04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      SPRG_19989 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  24141233 NCBI-ProteinID:  XP_012200520 UniProt:  A0A067CDF4 LinkDB All DBs Position Unknown AA seq 92 aa AA seqDB search MTSRDNNKQMETDMDEHGDMKSDVLMQASIAMEQYTDEKDISKHLKLWLEEKYGPTWHCI VGSEYKVSFTYESKNFIKFNVGKKCITLFRHN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgacgagccgcgacaacaacaagcaaatggagaccgacatggacgaacatggcgatatg aagagcgacgtcctcatgcaggcaagcattgccatggagcagtacacagatgaaaaggac atttccaagcacctcaagctgtggctcgaagaaaagtacggcccaacatggcattgcatc gtcgggtccgagtacaaggtgtcatttacttacgagagcaagaacttcatcaagtttaac gtcggcaagaagtgcataacgctcttccgccacaactag

DBGET integrated database retrieval system