Saprolegnia parasitica: SPRG_22179 Help Entry SPRG_22179        CDS       T04137                                  Name (RefSeq) hypothetical protein   KO K10419   dynein light chain roadblock-type Organism spar  Saprolegnia parasitica Pathway spar04814   Motor proteins Brite KEGG Orthology (KO) [BR:spar00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     SPRG_22179  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:spar04131]     SPRG_22179   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:spar03037]     SPRG_22179    04812 Cytoskeleton proteins [BR:spar04812]     SPRG_22179 Membrane trafficking [BR:spar04131]  Endosome - Golgi transport   Rab GTPases and associated proteins    Rab associated proteins     SPRG_22179 Cilium and associated proteins [BR:spar03037]  Motile cilia and associated proteins   Dynein arm    SPRG_22179 Cytoskeleton proteins [BR:spar04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      SPRG_22179 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Robl_LC7 LAMTOR5 Fuz_longin_1 Motif Other DBs NCBI-GeneID:  24142562 NCBI-ProteinID:  XP_012200582 UniProt:  A0A067CDT1 LinkDB All DBs Position Unknown AA seq 109 aa AA seqDB search MSGYEAEETIKRIKSHKGVQAVLIVNNDGVPIYSSTSDEEFAIDHAALISQLAAKAKSTI RTLDPTNDMTFLRIRSKKHEIMIAPDKEYALIVIQNPNAGTDAEITELA NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgtctgggtacgaggcagaggagacgatcaagcgcatcaagagccacaagggcgtccag gccgtgctcatcgtcaacaacgacggcgtcccgatctactcgagcacgagcgacgaggag tttgcgatcgaccacgcggccttgatctcgcagctcgcggccaaggccaagagcacgatc cggacgctggacccgacgaacgacatgacgttcctccgcatccgctccaagaagcacgag atcatgatcgcgcccgacaaggagtatgcgctcatcgtgatccagaacccgaacgcgggg accgacgccgagatcaccgagctcgcctaa

DBGET integrated database retrieval system