Streptococcus pantholopis: A0O21_06455 Help Entry A0O21_06455       CDS       T05054                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism spat  Streptococcus pantholopis Pathway spat01100   Metabolic pathways spat01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spat00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A0O21_06455    00074 Mycolic acid biosynthesis     A0O21_06455   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A0O21_06455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding HFX_2341_N DUF7080 PP-binding_2 BNR_3 Motif Other DBs NCBI-ProteinID:  AND79690 UniProt:  A0A172Q8B1 LinkDB All DBs Position complement(1399320..1399553) Genome browser AA seq 77 aa AA seqDB search MTELEKNVLELVAQAFNKDIADIGLDTTFKDDLAASSLVMVSLIANIEEELDVMIPISEA AKFKTVADLTAAVAAEA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgactgaattagagaaaaatgttttggaattggttgcacaggcttttaataaagatatt gccgatataggtttagatacaacctttaaagatgatttagctgcttcatcgcttgtcatg gtaagtttgattgccaatattgaagaagaactggatgttatgattcctatttctgaggcc gccaagtttaaaacagttgctgatttgactgcagctgtagccgcagaagcgtag

DBGET integrated database retrieval system