KEGG   Streptococcus pantholopis: A0O21_06915
Entry
A0O21_06915       CDS       T05054                                 
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
spat  Streptococcus pantholopis
Pathway
spat00770  Pantothenate and CoA biosynthesis
spat01100  Metabolic pathways
spat01240  Biosynthesis of cofactors
Module
spat_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:spat00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    A0O21_06915
Enzymes [BR:spat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     A0O21_06915
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: AND79776
UniProt: A0A172Q8I6
LinkDB
Position
complement(1509498..1509998)
AA seq 166 aa
MSNKIGLFTGSFDPVTNGHMAIIKSAGRLFDQLYVGLFYNKNKEGFFTAAKRRAMLEEAV
AGLSNVKVLAAHDSLAVDIAGQIGVTHLVRGLRNGRDLEYESELAFFNSHLAETIDTVFF
LPPADLSHISSSRIRELIHFHSDVSDFVPESVVKEVEKLGEDFTSL
NT seq 501 nt   +upstreamnt  +downstreamnt
atgtcaaataaaataggactttttaccggctcctttgaccctgtaacaaacgggcatatg
gcgattattaaaagcgcgggtcggcttttcgatcagctttatgtcggtctgttctacaat
aaaaataaggaaggtttttttacagcagctaagcgcagagccatgttagaagaggctgta
gccggtctcagcaatgtcaaagtgcttgcagctcatgattctctggcagttgatattgcc
ggacagattggcgttacgcatttggtgcggggcttaagaaacggcagagatttggaatat
gaaagcgaactggccttttttaacagccacttggcagagactatcgacactgtttttttt
ctgccgcctgctgacctgtcccatatcagttccagccgtattcgtgaattgattcatttt
cattcggatgtatcggattttgttccggaaagtgttgtaaaagaagtggagaaactaggt
gaagattttacaagtctttag

DBGET integrated database retrieval system