Sphingomonas paucimobilis: DRN02_001825 Help Entry DRN02_001825      CDS       T06034                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spau  Sphingomonas paucimobilis Pathway spau01100   Metabolic pathways spau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spau00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DRN02_001825    00074 Mycolic acid biosynthesis     DRN02_001825   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DRN02_001825 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N DUF1493 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  QBE90905 LinkDB All DBs Position 402364..402600 Genome browser AA seq 78 aa AA seqDB search MSETADRVKKIVVEHLGVEADKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVKDAITYIDENKA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgagaccgccgaccgcgtgaagaagatcgtcgtcgagcatctcggcgtcgaagcc gataaggtgaccgaggacgcgagcttcatcgacgacctcggtgccgacagcctcgacatt gtcgagctcgtcatggcgttcgaggaagagttcggtgtcgaaatcccggacgatgccgcc gagaagatcacgaccgtcaaggacgcgatcacgtatatcgacgagaacaaggcctaa

DBGET integrated database retrieval system