KEGG   Sphingomonas paucimobilis: DRN02_002925
Entry
DRN02_002925      CDS       T06034                                 
Symbol
phoB
Name
(GenBank) phosphate regulon transcriptional regulatory protein PhoB
  KO
K07657  two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
spau  Sphingomonas paucimobilis
Pathway
spau02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spau00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DRN02_002925 (phoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:spau02022]
    DRN02_002925 (phoB)
Two-component system [BR:spau02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   DRN02_002925 (phoB)
SSDB
Motif
Pfam: Response_reg Trans_reg_C GerE DUF7669 PDE8A_N GlnR_1st
Other DBs
NCBI-ProteinID: QBE91097
LinkDB
Position
complement(644626..645318)
AA seq 230 aa
MARVKMLLVEDDAALAELLVFHFKREDFEVVHTPDGEEALLLARENTPDIVLLDWMVEGI
SGIEVCRRLRRAPETANVPIIMLTARGEEEDRVRGLETGADDYVTKPFSPRELVARVGAV
LRRVRPALAGEALVYADIEMDTVGHKVRRAGEVVSLGPTEFRLLKHFLEHPGWVFSRERL
LDAVWGHDSDIESRTVDVHIRRLRKAINIGDRPDIIRTVRSAGYSLDAGV
NT seq 693 nt   +upstreamnt  +downstreamnt
atggcacgggtaaagatgttgctggtcgaagacgacgccgcgctggcggaactgctcgtc
ttccatttcaagcgcgaggatttcgaggtcgtccacacccccgatggcgaggaggcgctg
ctgctggcgcgcgagaacacgccggacatcgtcctgctcgactggatggtcgaggggatt
tcggggatcgaggtgtgtcgccgcctgcgccgcgcgccggagaccgccaatgtgccgatc
atcatgctgaccgcgcgcggtgaggaagaggaccgcgtgcgcgggctggagacgggcgcg
gacgattatgtgaccaagcccttctcgccgcgcgagctggtcgcgcgcgtcggtgccgtc
cttcgccgcgtccgccctgccttggccggcgaagccttggtctatgcggacatcgagatg
gatacggtgggtcacaaggtccgccgcgcgggcgaggtcgtctcgctcgggcccaccgaa
ttccgcctgctcaagcatttcctggagcatccgggctgggtcttctcgcgcgagcggttg
ctcgatgcggtctggggccatgattcggatatcgaaagccgcaccgtcgacgtgcatatc
cgccgcttgcgtaaggcgatcaacattggcgatcggcccgatatcatccgcactgtccgc
tcggcgggctattcgctggacgccggcgtctga

DBGET integrated database retrieval system