Sphingomonas paucimobilis: DRN02_006690 Help Entry DRN02_006690      CDS       T06034                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spau  Sphingomonas paucimobilis Pathway spau01100   Metabolic pathways spau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spau00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DRN02_006690    00074 Mycolic acid biosynthesis     DRN02_006690   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DRN02_006690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding RTG2_C Motif Other DBs NCBI-ProteinID:  QBE91737 LinkDB All DBs Position 1437204..1437476 Genome browser AA seq 90 aa AA seqDB search MELQASSEVEATVRGVLADVLGLSHERVAGFEADTPLFGALPELDSMAVAGVLTELEDRL DILIEDDEVDGEMLETFGQLVAFANTKARA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt ttggaactccaggcgagcagtgaggtggaagcaacggtgcgcggcgtactcgccgatgtg ctggggctgtcgcacgagcgtgtggcggggttcgaggccgatacgccgctgttcggcgcg ctgccggagctggattcgatggcggtcgcgggcgtgctgaccgagctggaggaccgcctg gacatcctgatcgaggatgacgaggtcgatggcgagatgctggaaaccttcggccagctg gtcgccttcgccaacaccaaggcgcgggcttga

DBGET integrated database retrieval system