Sphingomonas paucimobilis: DRN02_017085 Help Entry DRN02_017085      CDS       T06034                                  Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism spau  Sphingomonas paucimobilis Pathway spau00190   Oxidative phosphorylation spau01100   Metabolic pathways Module spau_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:spau00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     DRN02_017085  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:spau00194]     DRN02_017085 Photosynthesis proteins [BR:spau00194]  Photosystem and electron transport system   F-type ATPase [OT]    DRN02_017085 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  QBE93523 LinkDB All DBs Position 3648678..3648929 Genome browser AA seq 83 aa AA seqDB search MLHFELVTPEKLLRSEEVHMVVVPGTEGDFGVLEGHAPFMSTIRDGAIQVYRTDKGEPES IQIRGGFAEVGPKGLTVLAEHAG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgctgcacttcgaactcgtcacgcctgaaaagcttctccgttcggaggaggtgcatatg gtggtcgtccccggcaccgagggcgatttcggcgtgctggagggccatgcgcccttcatg tcgaccattcgcgacggcgcgatccaggtgtatcgcaccgacaagggcgagccagagtcg atccagatccgcggcggcttcgccgaggtggggcccaagggtctgaccgtgctggcggag catgctgggtaa

DBGET integrated database retrieval system