Sphingopyxis sp. BSN-002: L7H23_12845 Help Entry L7H23_12845       CDS       T10439                                  Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism spbs  Sphingopyxis sp. BSN-002 Pathway spbs00190   Oxidative phosphorylation spbs01100   Metabolic pathways Module spbs_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:spbs00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     L7H23_12845  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:spbs00194]     L7H23_12845 Photosynthesis proteins [BR:spbs00194]  Photosystem and electron transport system   F-type ATPase [OT]    L7H23_12845 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  UKK83447 LinkDB All DBs Position complement(2604009..2604266) Genome browser AA seq 85 aa AA seqDB search MALKFELVTPARLERSSDVYMVTVPGSEGDFSVLEGHAPFMATLRNGPLTIYATNGAAPE TIEVEGGFAEVNEAGLTVLAEHIAN NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggccctgaagttcgaactcgtcacccccgcccgcctcgagcggtcgagcgacgtctat atggtcaccgtgccgggcagcgagggcgatttctcggtgctcgaaggccatgcacccttc atggcgacgctgcgcaacggtccgctgaccatctatgccaccaacggcgccgcgcccgag acgatcgaggtcgaaggcggctttgccgaagtcaacgaagccggcctgaccgtcctcgcc gagcatatcgcgaactga

DBGET integrated database retrieval system