Shewanella putrefaciens CN-32: Sputcn32_0445 Help Entry Sputcn32_0445     CDS       T00513                                  Name (GenBank) phosphopantetheine-binding   KO K02078   acyl carrier protein Organism spc  Shewanella putrefaciens CN-32 Pathway spc01100   Metabolic pathways spc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Sputcn32_0445    00074 Mycolic acid biosynthesis     Sputcn32_0445   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Sputcn32_0445 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD InlK_D2 Motif Other DBs NCBI-ProteinID:  ABP74177 UniProt:  A4Y2J4 LinkDB All DBs Position complement(480078..480326) Genome browser AA seq 82 aa AA seqDB search MQNREQILAMLTTILVDEFEIDAEAITPEANLYEELDLDSIDAVDLVIKLQQLTGKKIQP DEFKSVRTINDVINAIEGLVKT NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcaaaatcgtgaacaaatcctcgctatgctgaccactatcttagtggacgaattcgaa attgatgccgaggcgattacgcctgaggccaacctgtatgaagagctcgatctcgacagt attgatgccgtcgacttagtgataaagctgcagcaactgacaggtaaaaagatccaaccc gatgagtttaaatcagttcgcacaatcaacgatgtgattaatgctatcgaaggtttagtt aaaacctaa

DBGET integrated database retrieval system