KEGG   Sphingobium sp. CAP-1: GL174_16870
Entry
GL174_16870       CDS       T10467                                 
Name
(GenBank) heavy metal translocating P-type ATPase
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
spca  Sphingobium sp. CAP-1
Brite
Enzymes [BR:spca01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     GL174_16870
SSDB
Motif
Pfam: E1-E2_ATPase Hydrolase YHS HMBD Hydrolase_3 HAD TRASH_HVO_1752_C Hydrolase_6 TatC 2-Hacid_dh SurA_N_3 MASE3
Other DBs
NCBI-ProteinID: QGP80764
LinkDB
Position
MIN2:538855..541218
AA seq 787 aa
MAESKHGVHSGVHSCCGDHGKHSAGLVVDPVCGMTVDPEKTAHHATYAGHDYHFCSPGCR
EKFIADPEAHLNKSAVEPVDAPPGTMWTCPMHPEIRQDHPGACPICGMGLEPEMVSADTG
PSAELLDMTRRFWIGLALALPVFILEMGGHLFPALHHLVPMKLSIWIQFALATPVVLWAG
WPFFERGWASLKTRNLNMFTLIAMGTGVAWAYSVVATLAPGIFPDAFRAADGTVAVYFEA
AAVITVLVLLGQVLELRARERTSGAIKALLNLAPKTARRIAEDGSEAEIPLEDVAVGDRL
RVRPGEKVPVDGVVEEGRSALDESMVTGESMPVTKSDGDSVIGGTMNQSGALVIRADKVG
RDTMLSRIVQMVAEAQRSRAPIQRMADQVSGWFVPVVIGVAVLAFVIWGVWGPEPRFAHG
LIAAVSVLIIACPCALGLATPMSIMVGVGRGAGLGVLIKNAEALEHMEKVDTLVVDKTGT
LTEGKPAVTRIVAADGYAESGLLRIAAGVERASEHPLALAIVDAATGRGIDIPPVSDFDS
PTGKGALGTVEGKRVTLGNARFLAESGIDTAPLVAEADALRGDGATTIFMGLDDRAVGIF
AIADPIKPTTPEALAALRADGIKVVMLTGDNRTTAEAVARQLGIDAVEADVLPDQKANVV
ARLKQEGRVVAMAGDGVNDAPALAAADVGIAMGHGTDVAMESAGVTLLKGDLNGIVRARQ
LSEATMSNIRHNLFFAFIYNAAGVPIAAGLLYPVFGILLSPMIAAAAMALSSVSVVANAL
RLNRVKL
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggccgagtcgaaacatggcgttcattccggtgtccacagttgttgtggtgaccatggc
aagcattccgccggactggtggtcgacccggtttgcggcatgacggtcgatcccgaaaaa
accgcgcatcacgcgacctatgctggccacgactatcatttttgcagccccggctgccgc
gagaagttcattgcggacccggaagcgcatctgaacaagtccgccgtcgaacccgtcgat
gcgccgccggggacgatgtggacctgcccgatgcatccggagatccggcaggaccatccc
ggcgcctgcccgatctgcggcatggggcttgagccggaaatggtcagcgccgataccgga
cccagcgccgagctgctcgacatgacacggcgtttctggattggccttgcgctggccctc
ccggtcttcatcctcgaaatgggcgggcaccttttcccggcgctgcatcatctcgtgccc
atgaagctgtcgatctggatccagttcgcgctggcgacgccggtcgtgctgtgggcgggg
tggccctttttcgagcgcggctgggcttcgctgaagacgcgcaatctcaacatgttcacg
ctgatcgcgatggggaccggcgtcgcatgggcctatagcgtcgtcgcgacgctggcgccc
ggtatcttcccggacgccttccgcgccgctgacgggaccgtcgcggtctatttcgaggcg
gccgccgtcattaccgtgctggtgctgctggggcaggtgctggaactgcgcgcgcgcgaa
cgcacatcgggcgcgatcaaggcattgctcaaccttgccccgaaaaccgctcggcgcatc
gccgaggacggcagcgaggcggaaatcccgctggaggatgtggcggtgggggaccggctg
cgggtgcggccgggcgaaaaggtgccggttgacggcgtggtcgaggaagggcgttcggcg
ctcgatgaatcgatggtcacgggcgaatccatgcccgtcaccaagtcggatggcgacagc
gtgatcggcggcacgatgaaccagagcggtgccctggtcatccgcgccgacaaggtcggg
cgcgataccatgctgtcgcgcatcgtccagatggtcgccgaggcgcagcgctcgcgcgcg
ccgatccagcgcatggccgatcaggtctcgggctggttcgtgccggttgtcatcggggtc
gctgtcctcgccttcgtcatctggggcgtctggggaccggagccgcgctttgcccatggg
ctgatcgcggcggtatcggtgctgatcatcgcctgcccctgcgcattggggctggcgacg
ccgatgtcgatcatggtcggcgtcgggcgcggggcggggcttggcgtgctgatcaagaat
gccgaagcgctggagcatatggagaaggtcgacacgctggtcgtcgacaagaccggcacg
ctgaccgaaggcaagcccgccgtcacccggatcgtcgcggcggatggctatgcggaaagc
gggttgctgcggattgccgccggcgtcgagcgcgcctcggagcatccgctggcgctggcg
atcgtcgatgcggcgacgggccgaggcatcgacattcctcccgtcagcgatttcgattca
cccaccggcaagggggcgctgggcaccgtcgaaggcaagcgggtcacattggggaatgcg
cgcttcctggcggaatcggggatcgataccgcgccgcttgtcgccgaggccgatgcactt
cgcggcgatggcgcgacgacgatcttcatggggctggatgatcgggccgtggggattttc
gccatcgccgatccgatcaagccgacgacacccgaggcgctggccgccctgcgcgccgac
ggcatcaaggtggtgatgctgaccggcgataatcgcaccacggctgaagcggttgcgcgt
caactcggcatcgatgcggtcgaggccgatgtgctgcccgaccagaaggcgaatgtcgtc
gcgcggctgaagcaggaaggccgcgtcgtcgccatggcgggcgatggcgtcaatgatgcc
ccggcgctggcggcggccgacgtcggcatcgcgatgggacatggcaccgacgttgccatg
gaaagcgcgggcgtgaccttgctcaagggcgatctcaacggcatcgtccgggcccgccag
ctcagtgaggcgacgatgtcgaatatccggcacaacctgttcttcgctttcatctacaac
gcggcgggtgtgccgatcgcggcggggctgctctatccggtcttcggcatcctgctctcg
ccgatgatcgcggcggcggcgatggcgctgtcgtcggtgagcgtcgtcgccaacgcgctg
cgcctcaaccgggtgaagctgtga

DBGET integrated database retrieval system