Sphingobium sp. CAP-1: GL174_17215 Help Entry GL174_17215       CDS       T10467                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism spca  Sphingobium sp. CAP-1 Brite KEGG Orthology (KO) [BR:spca00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:spca03032]     GL174_17215    03036 Chromosome and associated proteins [BR:spca03036]     GL174_17215    03400 DNA repair and recombination proteins [BR:spca03400]     GL174_17215 DNA replication proteins [BR:spca03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     GL174_17215 Chromosome and associated proteins [BR:spca03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     GL174_17215 DNA repair and recombination proteins [BR:spca03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       GL174_17215 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 GTP_EFTU_D2 DUF2267 DUF937 Glyco_transf_29 Motif Other DBs NCBI-ProteinID:  QGP80823 UniProt:  A0A6I5YVU4 LinkDB All DBs Position MIN2:complement(617671..617943) Genome browser AA seq 90 aa AA seqDB search MNKQDLISAVAESSGLSKNDATKAVEGVFDAISGALKKGDEVRLVGFGTFSVSQRKASTG RNPRTGETMTIKASAQPKFKAGKGLKDSVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagcaggatctgatcagcgcagttgctgaaagcagcggccttagcaagaatgac gcgaccaaggcagtcgaaggcgtattcgacgccatcagcggcgcgctgaagaagggcgac gaagtgcgcctcgtgggtttcggcactttctccgtttcgcagcgcaaggcttcgaccggc cgcaatccgcgcaccggcgaaaccatgaccatcaaggcgtcggcgcagccgaagttcaag gccggcaagggcctgaaggattcggtcaactga

DBGET integrated database retrieval system