Sphingomonas sp. CL5.1: F9288_05010 Help Entry F9288_05010       CDS       T11042                                  Name (Genbank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism spcl  Sphingomonas sp. CL5.1 Pathway spcl00190   Oxidative phosphorylation spcl01100   Metabolic pathways Module spcl_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:spcl00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     F9288_05010  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:spcl00194]     F9288_05010 Photosynthesis proteins [BR:spcl00194]  Photosystem and electron transport system   F-type ATPase [OT]    F9288_05010 SSDB OrthologParalogGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  QKR99081 LinkDB All DBs Position 994560..994811 Genome browser AA seq 83 aa AA seqDB search MLHFELVTPERLIRSEDVHMVTVPGSEGDFAVLEGHAPLMSTIRDGDLLVQRTAGGAPEA IAIRGGFAEVNAKGLTVLAEHAS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgctgcatttcgaactcgtcacgcccgaacgcctgatccgctccgaggacgtgcacatg gtcaccgtccccggctccgagggcgatttcgcggtgctggagggccacgcgccgctgatg tcgacgatccgcgacggcgacctgctcgtccagcgcaccgccggcggcgccccggaagcg atcgcgatccgcggcggcttcgccgaggtcaacgccaaggggctgacggtactggcggaa cacgcgagctga

DBGET integrated database retrieval system