Sphingomonas sp. CL5.1: F9288_12765 Help Entry F9288_12765       CDS       T11042                                  Name (Genbank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism spcl  Sphingomonas sp. CL5.1 Brite KEGG Orthology (KO) [BR:spcl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:spcl03032]     F9288_12765    03036 Chromosome and associated proteins [BR:spcl03036]     F9288_12765    03400 DNA repair and recombination proteins [BR:spcl03400]     F9288_12765 DNA replication proteins [BR:spcl03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     F9288_12765 Chromosome and associated proteins [BR:spcl03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     F9288_12765 DNA repair and recombination proteins [BR:spcl03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       F9288_12765 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  QKS00397 UniProt:  A0A6N0X1S6 LinkDB All DBs Position 2630870..2631145 Genome browser AA seq 91 aa AA seqDB search MNNNDLAEALAASNGITKANARKYVDDMFAAIAAAAAKGDEIALSGFGKFKVKRTEARDG RNPSTGETIKIAASNKLTFAPAKAVKDRLNG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt gtgaacaataatgacctcgccgaggcgcttgccgcgtccaacggcatcaccaaggccaac gcccgcaaatatgtcgacgacatgttcgccgcgattgccgccgccgcggccaagggcgat gagatcgccttgtcgggcttcggcaagttcaaggtgaagcgcaccgaggcgcgcgacgga cgcaatccgtcaaccggcgagacgatcaagatcgccgcgtcgaacaagctgaccttcgcg cccgcgaaagcggtcaaggaccggctaaacggctga

DBGET integrated database retrieval system