Serratia proteamaculans: Spro_0890 Help Entry Spro_0890         CDS       T00595                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism spe  Serratia proteamaculans Pathway spe00998   Biosynthesis of various antibiotics spe01100   Metabolic pathways spe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Spro_0890    00074 Mycolic acid biosynthesis     Spro_0890   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Spro_0890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABV39996 UniProt:  A8GA56 LinkDB All DBs Position 991121..991396 Genome browser AA seq 91 aa AA seqDB search MRYSGMNLLSTEIKQLIIDTLNLEGMTPEEIDAEAPLFGDGLGLDSIDALELGLALKNRY GVVLSAESQDMRQHFYSVETLAKFVSAQRSK NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagatatagcggaatgaatttattgagcaccgaaatcaagcaattgatcattgatacg ctcaatcttgaaggtatgacaccggaggagattgacgccgaggcaccgctgtttggtgat ggactgggtctggattccattgatgcattggaattgggcctggcattaaagaaccgttat ggcgtggtgctatcggcggaaagccaggatatgcgccaacatttttattccgtggaaacg ctggcaaagtttgtttctgcacagcgtagcaaataa

DBGET integrated database retrieval system