Serratia proteamaculans: Spro_0891 Help Entry Spro_0891         CDS       T00595                                  Name (GenBank) phosphopantetheine-binding   KO K02078   acyl carrier protein Organism spe  Serratia proteamaculans Pathway spe00998   Biosynthesis of various antibiotics spe01100   Metabolic pathways spe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Spro_0891    00074 Mycolic acid biosynthesis     Spro_0891   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Spro_0891 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABV39997 UniProt:  A8GA57 LinkDB All DBs Position 991406..991657 Genome browser AA seq 83 aa AA seqDB search MDKQEIYLQIQALLVKLFELDADDIKPESRLYEELELDSIDAVDLVVHLQKTTGKKIKPE MFKSVRTVQDVVDAIDELLKSDS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggataagcaagaaatttacctgcagattcaggcgttgctggtcaaactgtttgaactt gatgccgatgatatcaagcccgagtcccgtctgtatgaagagctggagctggacagcatt gatgcggtggatctggtggtacacctgcaaaaaacaaccggcaagaagatcaaaccggaa atgttcaagtcggtgcgcaccgtgcaagacgtagttgatgccattgatgagttgcttaag tcagacagttaa

DBGET integrated database retrieval system