Serratia proteamaculans: Spro_1696 Help Entry Spro_1696         CDS       T00595                                  Name (GenBank) conserved hypothetical protein   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism spe  Serratia proteamaculans Pathway spe00362   Benzoate degradation spe00621   Dioxin degradation spe00622   Xylene degradation spe01100   Metabolic pathways spe01120   Microbial metabolism in diverse environments spe01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:spe00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     Spro_1696    00622 Xylene degradation     Spro_1696    00621 Dioxin degradation     Spro_1696 Enzymes [BR:spe01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      Spro_1696 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase P22_CoatProtein Tautomerase_3 Motif Other DBs NCBI-ProteinID:  ABV40800 UniProt:  A8GCG0 LinkDB All DBs Position 1857457..1857672 Genome browser AA seq 71 aa AA seqDB search MKIQHFPQVLSQTAKNALAEEITRAITQALQCDAGVVSIAIEPVSADDWQAQVYRPEIEN KKDCLIKVPNY NT seq 216 nt NT seq  +upstreamnt  +downstreamnt gtgaaaattcagcactttccgcaggtactttcccaaactgccaagaatgcactggcagag gagataacgcgggctattacgcaagcattacagtgcgatgccggcgtcgtctccattgca atagagccggtatctgccgatgactggcaggcgcaggtttatcgcccggaaatagaaaat aaaaaagactgtttaattaaagtccctaattactga

DBGET integrated database retrieval system